PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00145.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 768aa    MW: 82636.6 Da    PI: 8.8096
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00145.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-17118162348
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +WT+eEd +l + v q+G + W+ Ia++++ gR +kqc++rw +yl
  Zpz_sc00145.1.g00010.1.am.mk 118 SWTEEEDSILREMVLQYGERKWSVIAQCIP-GRIGKQCRERWINYL 162
                                   7*****************************.*************97 PP

2Myb_DNA-binding54.13.6e-17170211245
                                   SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                   ++WT++Ed  l++a+k +G++ W++Ia++++ gR+++ +k++w+
  Zpz_sc00145.1.g00010.1.am.mk 170 DAWTEDEDRMLINAHKFYGNR-WSSIAKYLP-GRSENAIKNHWN 211
                                   58*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.003111166IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-22112164IPR009057Homeodomain-like
SuperFamilySSF466891.55E-30114210IPR009057Homeodomain-like
SMARTSM007171.6E-16115164IPR001005SANT/Myb domain
PfamPF002491.1E-15118162IPR001005SANT/Myb domain
CDDcd001672.98E-15118162No hitNo description
Gene3DG3DSA:1.10.10.602.6E-20165215IPR009057Homeodomain-like
PROSITE profilePS5129419.595167218IPR017930Myb domain
SMARTSM007173.4E-16168216IPR001005SANT/Myb domain
PfamPF002491.5E-15171211IPR001005SANT/Myb domain
CDDcd001672.84E-14171214No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 768 aa     Download sequence    Send to blast
MAGRSSVPID EVEAALMADW SPMVYFGSSY HGNDGFQNGM VPASTLAGAD QIMGAPVDVT  60
SLVDSIGMTP AGFEMPEGAL AATDFGVVGG EFPAGGTMSS QQQIGSSKKP PASLKASSWT  120
EEEDSILREM VLQYGERKWS VIAQCIPGRI GKQCRERWIN YLRPNIKQND AWTEDEDRML  180
INAHKFYGNR WSSIAKYLPG RSENAIKNHW NATLRSLKAQ RRMKKRKSEQ VPTGQFSALE  240
EYIRSQWPKD AVPAAPPPLP LSAPQPHLAY GSGLLHPAAH APAAGSATIP TNREMSFHGD  300
NSAAGSANLA GMINLNMPQT LPDPNTISGR QEYYLNYATM YAPAPAPQMH LTPTQDPMQV  360
VSNLDLSPYA EYFALLCPDY GRYNYAGASS SNPAGANGYY NEAGRGAAGA GGGDPAARHT  420
DGVVDGRWRG GRGRQRRWWD GRGRRRRGTG AIGSGDGRTS VVGGGRGWAW WVAAMVGLAH  480
HTSHYHSTAW PSRAENGTDK SNRSLAMWIG GAACVNRRGL EEGMLVSTDG LGGFAQRPTL  540
LDLLLELFGA GLEVVAKHPE LGLCRHVDKN WARVLAWEAY SIIEKAAGPK FAPFVYGFVC  600
APVILLGTGA IVALLFGKSP KSKVFIKYAT VLSIVATVAS VLFALILQDI RLKASSIQFM  660
LKLPSVTLVL EEAGLRGDRV TTSDSAQALN KLQKSVDNLE SKVEDNKREF GQLRSQVDLT  720
MGGLTLVQQE QVQVTKLLRS AHLLPETSSD AGVVGTQSAD TLSGAPAV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C7e-371192157102C-Myb DNA-Binding Domain
1mse_C7e-371192157102C-Myb DNA-Binding Domain
1gv2_A7e-371192157102MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-368421528156MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-368421528156MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1219226QRRMKKRK
2220226RRMKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972257.11e-111PREDICTED: uncharacterized protein LOC101784221
TrEMBLK3XS581e-111K3XS58_SETIT; Uncharacterized protein
STRINGSi004755m1e-111(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.17e-40myb domain protein 98